SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7M320 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D7M320
Domain Number - Region: 90-135
Classification Level Classification E-value
Superfamily Stathmin 0.0432
Family Stathmin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7M320
Sequence length 138
Comment (tr|D7M320|D7M320_ARALL) Uncharacterized protein {ECO:0000313|EMBL:EFH50440.1} KW=Complete proteome; Reference proteome OX=81972 OS=Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). GN=ARALYDRAFT_910454 OC=Arabidopsis.
Sequence
MDDPKLLNGDHIPGFKGYAVNMIDLAPEELTIQTYSGYGLRETLFYNLFENLQVYETQKQ
VEAAHAVSLDGFIAKENGFIYSGCSKPEIHFPVTVKEDEEEKLRKLEAARDRVRMAAKKI
EEEKCSLRKLENKNEENK
Download sequence
Identical sequences D7M320
XP_002874181.1.15461 59689.scaffold_602511.1 jgi|Araly1|910454|scaffold_602511.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]