SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D8S383 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8S383
Domain Number 1 Region: 192-257
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-20
Family DNA-binding domain from rap30 0.0027
Further Details:      
 
Domain Number 2 Region: 6-122
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000497
Family Rap30/74 interaction domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8S383
Sequence length 262
Comment (tr|D8S383|D8S383_SELML) Transcription factor {ECO:0000313|EMBL:EFJ21220.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_449480 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MSGADDGSVPLDVAQAEGQVWLLKLPAIVATAWNAQDSSGKSVAAGAGPADPTLAKVTCT
FDPLNPDPEAALEFTMELSGPDDIKAYSLNLQKDVVPTHIFSDTQGRLAVEGKVERKFDI
KPNSKAREEYRQLCRERDRKFNMKTRTIQVLKDDRGNLMRPALPPTIMLQSSKDAAKRKA
PVNAKNNDGKRTRRERGELEDHVFKLFEQQANWALKQLVQRTDQPVAFLKEILNDLCTYN
KRGTNQGTYELKPEYRKNPVEE
Download sequence
Identical sequences D8S383
XP_002977882.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]