SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D9S2Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D9S2Z4
Domain Number - Region: 140-178
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.0196
Family Rabenosyn-5 Rab-binding domain-like 0.013
Further Details:      
 
Domain Number - Region: 23-122
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0575
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9S2Z4
Sequence length 212
Comment (tr|D9S2Z4|D9S2Z4_THEOJ) DivIVA domain protein {ECO:0000313|EMBL:ADL07771.1} KW=Complete proteome; Reference proteome OX=555079 OS=JW/IW-1228P). GN=Toce_1009 OC=Thermosediminibacter.
Sequence
MILTPLDIQKKEFRKSFRGYSEDEVKDFLEKVTQSYEKIYRENQDLKEEVKFLKEKLQGY
QEMESTLKKAIILAEKAAEDLRKNAEREKELILKSARSKAMEMMGRAEARYNAINDQYEE
VKRQFMLFKTRFLNFLQSQIDLINAIVIEEEDLEKQPDKAEEYIEQAAAGRDFENEETEE
EGTIRDKVAKLRSDAENDDRGKETVGSGDNSV
Download sequence
Identical sequences D9S2Z4
gi|302389573|ref|YP_003825394.1| WP_013275811.1.79428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]