SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E0SPH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E0SPH3
Domain Number 1 Region: 308-468
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-54
Family DNA gyrase/MutL, second domain 0.00000198
Further Details:      
 
Domain Number 2 Region: 17-228
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-36
Family DNA gyrase/MutL, N-terminal domain 0.000000491
Further Details:      
 
Domain Number 3 Region: 231-303
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000000000379
Family Topoisomerase VI-B subunit middle domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E0SPH3
Sequence length 528
Comment (tr|E0SPH3|E0SPH3_IGNAA) Type II DNA topoisomerase VI subunit B {ECO:0000256|HAMAP-Rule:MF_00322} KW=Complete proteome; Reference proteome OX=583356 OS=Ignisphaera aggregans (strain DSM 17230 / JCM 13409 / AQ1.S1). GN=Igag_0063 OC=Desulfurococcaceae; Ignisphaera.
Sequence
MSATAEKFRSISPAEFFYRNKEIAGFANPARALYQAVRELVENALDATDAHGILPNIEVS
IERDSVKQYVYRISVKDNGIGIPEKYIPEAFGKVLFSSKYVLRQTRGLFGLGAKMVILYG
QMTVGEPAEIISAAINSRRIYSYRIMIDVRENKPIIVSKGVWPNNTGWHGTMVKVAIEGD
WSRAKQKILDYIKRTAIVTPYANIVFKTPDGEIYTYLRVTETIPPPPRETKPHPHGVDLE
LIKTMISETKAQRLIDFISEEFQGVGNVIAERFLTKYGFDPSKDPKTLSKEELELLVKAL
KEFNEFRKPRADHLSPIGAELIKIGLNSILKPEFVDAVTRKPVVYEGHSIIVEVGIAYGG
SIQPSEEVVLLRYANKIPLLYDEKSDVAWKVVSENIDWSYYGIVFPAPLAILVHICGTKI
PYKGVGKESIAEVPVIEKEIEEGVRQVARSLKLYLARKQKEEEMMRKAVTIIKYVPEVAR
NLAVLSKANPVRIDEKELEMKIFELVKHKYGEYLNNISSPYDIVIGIE
Download sequence
Identical sequences E0SPH3
gi|305662508|ref|YP_003858796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]