SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BKN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BKN8
Domain Number 1 Region: 284-404
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-27
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 2 Region: 407-445
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000085
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1BKN8
Sequence length 445
Comment (tr|E1BKN8|E1BKN8_BOVIN) Suppressor of cytokine signaling 6 {ECO:0000313|Ensembl:ENSBTAP00000023144} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SOCS6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKKISLKTFRKSFNLSKSKEDAEFMVVQQPALAGDFGKEESLFGSCYGKEMAGCELHGED
EKGGGGKNRAKSESLMGTLKRRLSAKQKAKGKGGAAAGGAADEDTFSSSSAPLVFKDARA
PRPMRSTSLRSHHYSPTPWPLRPTASEETCIRMEVRVKALVHSPGTGPALNGVRKDFGEL
RPAAEPACPCPEPPAAPGSPAPVAGDLRLRLGEHVPVVLGLLPQDYLPYTVPLDGSSPMX
GPDAHAADSVRCHLNFDPTSAPGVARVYDSVQSSGPLAVTSLTEELKKLAKQGWYWGPIT
RWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEG
HTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQ
YTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences E1BKN8
ENSBTAP00000023144 ENSBTAP00000023144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]