SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BPM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1BPM6
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily POZ domain 1.67e-23
Family BTB/POZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 459-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 501-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000111
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 548-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000004
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 346-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000222
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 6 Region: 290-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000564
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 
Domain Number 7 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000213
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1BPM6
Sequence length 688
Comment (tr|E1BPM6|E1BPM6_BOVIN) Zinc finger and BTB domain containing 48 {ECO:0000313|Ensembl:ENSBTAP00000022249} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ZBTB48 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDGSFVQHSVRVLQELNKQRERGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSG
GSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKASV
GQPPSGQSGLGKSAPRDVNSHLKESAGVEKEEVSRTLGQIPRDPELSGSLSPQRPRLGLP
AQSESPSFLRGKLKQALKLCPPGDKEPEDCKVPPRPFEAEGVQLQGGTNEWEVVVQVEDD
GDGDYDSETETVPTKRKANVIRKPCAAEPARSVGSLAAEPAENRKGTAVPVECPTCHKKF
LSKYYLKVHNRKHTGEKPFECAKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFR
RRMELRVHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRT
ELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPYVCEFCSHAFTQKANL
NMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHV
ASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIH
DRVENYNPRQRKLRNLVIEDEKMVVVALQPPPDLEVGSAEVIVESLAHGSLASQLPGQRL
CAEESFTGAGVMEPSLIITAAIPEDCDT
Download sequence
Identical sequences E1BPM6
NP_001179908.1.59421 NP_001179908.1.76553 ENSBTAP00000022249 ENSBTAP00000022249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]