SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1BX01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E1BX01
Domain Number - Region: 76-136
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0183
Family RecG, N-terminal domain 0.017
Further Details:      
 
Domain Number - Region: 129-195
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0824
Family Glutamyl tRNA-reductase dimerization domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1BX01
Sequence length 292
Comment (tr|E1BX01|E1BX01_CHICK) Protein MAK16 homolog {ECO:0000256|PIRNR:PIRNR003352} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=MAK16 OC=Phasianidae; Phasianinae; Gallus.
Sequence
MHSDDIVWDTLGNKQFCSYKIRTKTQSFCRNEYNLTGLCNRSSCPLANSQYATIREEKGR
CYLYMKTIERAPFPRRLWERVLLSKNYEKALEEIDENLIYWPRFIRHKCKQRFTKITQYL
IRIRKLTLKRQRKIVPLSRKIERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYN
FPIHAFDKALQQQDAESESESDMEKEDDDDEDKDKREFVEADDSDLSDFEDMDKLETSSE
EEQEDEEETEKKATHSKSKGKTPLKGPTRRKRPYIEIEYEEETEPASKTKVS
Download sequence
Identical sequences E1BX01
XP_424533.2.86415 ENSGALP00000002546 ENSGALP00000002546 9031.ENSGALP00000002546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]