SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1KMN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E1KMN5
Domain Number - Region: 57-85
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0445
Family Tubulin chaperone cofactor A 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1KMN5
Sequence length 124
Comment (tr|E1KMN5|E1KMN5_9BACT) Septum formation initiator {ECO:0000313|EMBL:EFL47254.1} KW=Complete proteome; Reference proteome OX=866771 OS=Prevotella disiens FB035-09AN. GN=HMPREF9296_0307 OC=Prevotella.
Sequence
MKETIVEESAVKKISGHIYYFFSRFKYHIVIILGLLVVGVLDENSFRRRIECYYQIQDLN
AEIEKYEKEYQHDTQRLRELKQNPNAIAKIARERYFMKADDEDIFVLSDDEQPTTNNNIN
ETTE
Download sequence
Identical sequences E1KMN5 U2JA42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]