SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2A9H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E2A9H4
Domain Number - Region: 10-78
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 0.0248
Family Dimerization motif of sir4 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2A9H4
Sequence length 110
Comment (tr|E2A9H4|E2A9H4_CAMFO) Uncharacterized protein {ECO:0000313|EMBL:EFN69914.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_04630 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
SESWCSWQRAKTANDLAKYNHNPAICNEVYEAIKPIYDDLSRDELLQRCLGGYTQNTNEC
FNKVVWTIAPKNSSGGKLLLDVGIDVATLTFNDGLMSLAKVLEVIGVKIG
Download sequence
Identical sequences E2A9H4
Cflo_14735--XP_001607093.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]