SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2L5T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2L5T9
Domain Number 1 Region: 37-62
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000034
Family EB1 dimerisation domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2L5T9
Sequence length 113
Comment (tr|E2L5T9|E2L5T9_MONPE) Uncharacterized protein {ECO:0000313|EMBL:EEB99212.1} KW=Complete proteome; Reference proteome OX=554373 OS=(Witches'-broom disease fungus) (Marasmius perniciosus). GN=MPER_01151 OC=Moniliophthora.
Sequence
GTRAGLNAGGSRSGGKTPIGGHRAGSTQPQNDAAVLHLQNQVKEMSGALEGLEKERDFYF
EKNTCPRGNMETPSKAKSEKKSPMVEGQGPSTIFSFSEPEGLTKTRALQNGPR
Download sequence
Identical sequences E2L5T9
gi|215474485|gb|EEB99212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]