SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2LQD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E2LQD4
Domain Number - Region: 92-162
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.000484
Family ETX/MTX2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2LQD4
Sequence length 208
Comment (tr|E2LQD4|E2LQD4_MONPE) Uncharacterized protein {ECO:0000313|EMBL:EEB92367.1} KW=Complete proteome; Reference proteome OX=554373 OS=(Witches'-broom disease fungus) (Marasmius perniciosus). GN=MPER_09136 OC=Moniliophthora.
Sequence
MHCASFVALALAMAVSAAPSYQQLEARKDVDRPDPTNLDHCPGRPMDDADACTFEKQKDI
PDRRRWFILGDPVANCDDPNAPALETQVGGEKTTTETWTHTDKAEINLAGIKIGGEGGWE
KSESKTERQLITVKIPAGKQRAVVAGVNHKESEGRIRLNYGDPTGEPGKDDYHYIWYNNG
VVSSQPTDDVEYDSKEINCGEQFDLSNL
Download sequence
Identical sequences E2LQD4
gi|215456094|gb|EEB92367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]