SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3CE16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E3CE16
Domain Number - Region: 14-104
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00961
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3CE16
Sequence length 119
Comment (tr|E3CE16|E3CE16_STRPA) Uncharacterized protein {ECO:0000313|EMBL:EFQ54939.1} KW=Complete proteome OX=905067 OS=Streptococcus parasanguinis F0405. GN=HMPREF9626_1163 OC=Streptococcus.
Sequence
MNYDQQLSELRRQEDFLYQKEREIVKEKRNLENEMNRFEGFSSEAHRYLWDAFESYPSSR
NFFDQLQEGVIHESRKISNSYLEELDELTIQKRKVEDDLNDIYHERKKLMIEKECDDGN
Download sequence
Identical sequences E3CE16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]