SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3E7E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3E7E6
Domain Number 1 Region: 181-471,502-751
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.02e-231
Family alpha-D-glucuronidase/Hyaluronidase catalytic domain 0.000000000000502
Further Details:      
 
Domain Number 2 Region: 11-153
Classification Level Classification E-value
Superfamily beta-N-acetylhexosaminidase-like domain 1.03e-22
Family alpha-D-glucuronidase, N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3E7E6
Sequence length 752
Comment (tr|E3E7E6|E3E7E6_PAEPS) Xylan alpha-1,2-glucuronidase {ECO:0000256|RuleBase:RU361198} KW=Complete proteome; Reference proteome OX=886882 OS=Paenibacillus polymyxa (strain SC2) (Bacillus polymyxa). GN=PPSC2_24465 OC=Paenibacillus.
Sequence
MSKRMDMPKGSGYDAWLHYHRARLIEKMPAWCRVIVVHDTDDEVLQTAASELQQGLASMF
GQQPKMSTVPVHVPFVALGTFQDHPCIAERFSAEEQAEVSAEGYRIRGVEAKQLADSTGQ
DHDDIKGQCVTVAGQNSKGVLYGVFHLLRYLQGGLDGKLKPTAKESLHAPSLDLLSNPAN
PIRMINHWDNMDGSVERGYAGPSIFYNNNAFTTNMERLRDYARLLASVGIQALSINNVNV
HQVETELITDRFLPDVAKVAAIFRAYGIQIYLSINYASPIQLGGLTTADPLDPGVAEWWQ
TKAREIYAAVPDLGGFVVKADSENRPGPFSYGRHHADGANMLADALRPYGGRVIWRCFVY
DCKQDWRDRKTDRARAAFDHFKPLDGLFRDNVILQIKNGPMDFQVREPVSPLFGALEATQ
VLLEFQIAQEYTGQQKHLCYLVPQWKEVLDFDTYAQGKGSTIKRIVSGALHSNSESGSHH
RKATVHAGSGSFQEEPTNHVPKGTNFGIAAVSNIGADTNWTGHLLAQSNLYGYGRLSWDP
DLSADEIADEWVRLTFSNQGKDCGDPELIPTIKQMLLDSWNIYESYTAPLGVGWMVSPNH
HYGPDVDGYEYSMWGTYHFADCWGIGVDRTTATGTGYAGQYFPPVAEIYESTDTCPDELL
LFFHHVPYTHVLHSGQTVIQHIYDTHFEGAERAAHLQATWISLREHLNELIYEQVLTRLE
HQTEHAKEWRDRINTYFYRKSGIPDEKNRPIY
Download sequence
Identical sequences E3E7E6
gi|310644639|ref|YP_003949398.1| gi|507717813|ref|YP_008050422.1| WP_013373691.1.14980 WP_013373691.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]