SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3EEG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3EEG8
Domain Number 1 Region: 176-397
Classification Level Classification E-value
Superfamily SGNH hydrolase 2e-49
Family YxiM C-terminal domain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 31-167
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-26
Family YxiM N-terminal domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3EEG8
Sequence length 403
Comment (tr|E3EEG8|E3EEG8_PAEPS) Lysophospholipase {ECO:0000313|EMBL:ADO55419.1} KW=Complete proteome; Reference proteome OX=886882 OS=Paenibacillus polymyxa (strain SC2) (Bacillus polymyxa). GN=PPSC2_06910 OC=Paenibacillus.
Sequence
MIGLCVGFSLLFATILIPGQALAEKQLAAPLRFDFGPGDVADGYTQVTAKDAYTPERGYG
FTDLSKVNGENRGGSDAIRSDFVRVQGSSFVVNLPPADYTLSLIAGDIAGNTDIMVKAES
IVKVEPTAKTAGQFVEAGFELALIDGQLELYFSGNEAKINALVITPKGARTAGEHPSVYL
AGDSTVQTYKSSMKPQAGWGQMIAPFFTDETIFVNRSIGGRSTKTFLVQGRLDDILRNIR
PGDYLFIQFGHNDAAINNQERYVSPADYKVYLKTYIQGATQRGAVPVLITPVGRRDYDAA
SASFRISFPEYVQAMKETASETGVALVDLSQLSVAYYDTLGLEGTLPLFLHLEPGVYSAF
PDGVKDDTHFQEYGAEQIARLVAQGVRDLNIPLSSYVKAENLQ
Download sequence
Identical sequences E3EEG8
gi|386040002|ref|YP_005958956.1| WP_013370050.1.14980 WP_013370050.1.91857 gi|310640902|ref|YP_003945660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]