SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3EH22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3EH22
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily YugE-like 0.000000000000759
Family YugE-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3EH22
Sequence length 80
Comment (tr|E3EH22|E3EH22_PAEPS) Uncharacterized protein {ECO:0000313|EMBL:ADO55582.1} KW=Complete proteome; Reference proteome OX=886882 OS=Paenibacillus polymyxa (strain SC2) (Bacillus polymyxa). GN=PPSC2_07660 OC=Paenibacillus.
Sequence
MNNDIVQMINEWNPIEIYPLLEDEYYSEIHKIHEKSKETNSIRELAKQIHSVFAQSFKKE
FDKSIEDCQSIAEKIMNITK
Download sequence
Identical sequences E3EH22
gi|310641065|ref|YP_003945823.1| gi|386040146|ref|YP_005959100.1| WP_013370209.1.13814 WP_013370209.1.14980 WP_013370209.1.31500 WP_013370209.1.41886 WP_013370209.1.91857 WP_013370209.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]