SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3GW55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3GW55
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Nop10-like SnoRNP 1.96e-20
Family Nucleolar RNA-binding protein Nop10-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3GW55
Sequence length 57
Comment (tr|E3GW55|E3GW55_METFV) Ribosome biogenesis protein Nop10 {ECO:0000256|HAMAP-Rule:MF_00803} KW=Complete proteome; Reference proteome OX=523846 OS=V24 S). GN=Mfer_1025 OC=Methanothermaceae; Methanothermus.
Sequence
MKMKKCKVCGEYTLKDKCPYCGGEVRIPRPARFSPEDKYGKYRRILKKQTILRGEKT
Download sequence
Identical sequences E3GW55
gi|312137245|ref|YP_004004582.1| WP_013414098.1.12012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]