SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3MIR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E3MIR1
Domain Number - Region: 35-104
Classification Level Classification E-value
Superfamily Proteasome activator 0.0471
Family Proteasome activator 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3MIR1
Sequence length 129
Comment (tr|E3MIR1|E3MIR1_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFP02569.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_02432 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSTILQVVTMEKQRKLSLSMRFFVKSSIVKKVNEETNKAELRKLAPRYRHRRVNFQSCVR
RSLPIDDVDQYLEEFNQEKWIGRRFQVEDIENLFNFNLDIYIKEKELEKGFEKELLEEYP
NSFVGHFYE
Download sequence
Identical sequences E3MIR1
31234.CRE02432 XP_003103959.1.11157 CRE02432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]