SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4Q3J7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4Q3J7
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily TM1646-like 3.79e-30
Family TM1646-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4Q3J7
Sequence length 148
Comment (tr|E4Q3J7|E4Q3J7_CALOW) Uncharacterized protein {ECO:0000313|EMBL:ADQ03957.1} KW=Complete proteome; Reference proteome OX=632518 OS=Caldicellulosiruptor owensensis (strain ATCC 700167 / DSM 13100 / OL). GN=Calow_0370 OC=Caldicellulosiruptor.
Sequence
MRVEDVKRNNINNVTFFQDQRRVERPKDSFSSYVKQLEKDEIINRIKELINKIDSLGKKL
AEKLDLSTLKEYKKSIKELLGYTVYSSHEYFNESLFGRKGRHKVFGIIKKIDEKMDMLTQ
EILKKEADNLKVLSYVGEIKGLLVDLFI
Download sequence
Identical sequences E4Q3J7
WP_013411369.1.29544 gi|312134419|ref|YP_004001757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]