SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4X3G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4X3G5
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-46
Family Calponin-homology domain, CH-domain 0.00000113
Further Details:      
 
Domain Number 2 Region: 201-273
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.32e-16
Family EB1 dimerisation domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4X3G5
Sequence length 283
Comment (tr|E4X3G5|E4X3G5_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY18169.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00017806001 OC=Oikopleura.
Sequence
MAVNVALTSATSDNLSRHDMISWINTSLSLQHKKIEELCNGAVYCQFMDMLFPGSIRLKM
VKYNAKHEHEFVNNFKSLQNAFKKMGVDKVIPVERLVKGRFQDNFEFVQWFKKFFDANYQ
GEPYDPVNARANAGVAPAGKPAAAKPAMNATARPAMNSTARKAPARVGAPAARVPAAPRT
PASSRPAAGGGGDSKRLQSQVDDLNTQLATMKDSLESLEKERDFYFEKLRDIELMCNNVC
GDEATVEVDPESETYKVTKKILDVLYATADGFEVPEEEEQDEY
Download sequence
Identical sequences E4X3G5
GSOIDT00017806001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]