SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4XE15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4XE15
Domain Number 1 Region: 92-124
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000144
Family Somatomedin B domain 0.0047
Further Details:      
 
Domain Number 2 Region: 126-176
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000051
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4XE15
Sequence length 299
Comment (tr|E4XE15|E4XE15_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY19405.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00008416001 OC=Oikopleura.
Sequence
MKYFWHFKFFRIKKTPAGKTQAAKIARLLSTSQPAASVLTTAQVLTHRLMNALSLSLACR
ILILKDNQKVKNCLQGCTGAVDHEQQNDPSFETVPSSRPCFCDDRCAQLGDCCHDFADTC
KYPKSCATMSAWSNWSKCKLPSEKSCGKGVIIRTRQPKNDDVRCFSSGRKEQKRTCRKRC
PLHKSSAASIFPAPATFRKQLEIESGDYCHLYKITRRSSSCTAQKRVYKNICVACRADIA
PSSGCSGSVEASRGSWTIENFNGLPYCHGRWINFYKKGMSVKTSFDLLNIFIFFVLYFH
Download sequence
Identical sequences E4XE15
GSOIDT00008416001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]