SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4YLU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E4YLU6
Domain Number - Region: 28-106
Classification Level Classification E-value
Superfamily Proteasome activator 0.0549
Family Proteasome activator 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4YLU6
Sequence length 147
Comment (tr|E4YLU6|E4YLU6_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY36457.1} OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00029464001 OC=Oikopleura.
Sequence
MNFIFIFICLTHCIPGIILKKKEVCKDHYCEVCYDVIHFDKKGNNYSDLVQYGCKKLFEL
KNCCSLYLNGQGPFISRGAPITISQLEKLFSRVELIKIPAYNSSDTPVEEINIPENGNYK
MGFHLRNAILGFFLGVIIFLMKIFCKI
Download sequence
Identical sequences E4YLU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]