SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4ZFM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4ZFM2
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily Fic-like 0.000000017
Family Fic-like 0.017
Further Details:      
 
Weak hits

Sequence:  E4ZFM2
Domain Number - Region: 89-122
Classification Level Classification E-value
Superfamily MTH889-like 0.0222
Family MTH889-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4ZFM2
Sequence length 123
Comment (tr|E4ZFM2|E4ZFM2_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:CBR26906.1} KW=Complete proteome; Reference proteome OX=861448 OS=Streptococcus phage phi-SsUD.1. GN= OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales.
Sequence
MKVLTVEQVIELHTRLIQATGGLDGVRDVGLIESSLSSAFITYFGVEKYPSIEEKAARLC
YSLVNNHAFLDGNKRIGVFVMIIFLELNGIVLNQTDDEVVKLGIGVASSELDYDAILEYI
RNH
Download sequence
Identical sequences E4ZFM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]