SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E5AFL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E5AFL3
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 4.71e-21
Family Tubulin chaperone cofactor A 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E5AFL3
Sequence length 111
Comment (tr|E5AFL3|E5AFL3_LEPMJ) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=985895 OS=Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam). GN=LEMA_P007890.1 OC=Leptosphaeria maculans species complex.
Sequence
MAPPSRLAIATSVVNRLVKEEASYHKELAQQETRIQKHETSEGDENAEYTLRQERQALQE
TKNVLSGMKTKIQAALEKLEDELENGEASEAEVTKAKEAIAVGKDAIKEAS
Download sequence
Identical sequences E5AFL3
XP_003845481.1.65998 CBY02002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]