SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E5AVX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E5AVX7
Domain Number - Region: 6-80
Classification Level Classification E-value
Superfamily ImpE-like 0.00706
Family ImpE-like 0.026
Further Details:      
 
Domain Number - Region: 68-157
Classification Level Classification E-value
Superfamily Aldolase 0.0681
Family HMGL-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E5AVX7
Sequence length 179
Comment (tr|E5AVX7|E5AVX7_PARRH) PLASMID PROTEIN {ECO:0000313|EMBL:CBW77279.1} KW=Complete proteome; Reference proteome OX=882378 OS=(Burkholderia rhizoxinica). GN=RBRH_00679 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MTIYSNALDARVQWALHRISVVAGDEKAAQAQLSLALTYAERSAEVAARKDEDVQCPALL
ADVPQLRAAFMGAVESVRDQRQKRRTREGIEAEIEAIDRQVSRSCGLSYELFVMRFSAEV
DYFLETVEAPYQALALEVAATMGYATPAEREEMQNEIEESGGCPLTGIDPDCCPCGRHP
Download sequence
Identical sequences E5AVX7
gi|330399503|ref|YP_004030601.1|NC_014723 WP_013436684.1.41379 gi|330399503|ref|YP_004030601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]