SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E5SJK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E5SJK4
Domain Number 1 Region: 91-152
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 1.57e-20
Family Delta-sleep-inducing peptide immunoreactive peptide 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E5SJK4
Sequence length 190
Comment (tr|E5SJK4|E5SJK4_TRISP) TSC22 domain protein 1 {ECO:0000313|EMBL:EFV55030.1} KW=Complete proteome; Reference proteome OX=6334 OS=Trichinella spiralis (Trichina worm). GN=Tsp_08426 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MSTAEATTFWPNERRYSEPAPSLSLKILLDTLYGDTSQAATGGTTSANGSGSSVVAIDNK
IEQAMLCNGTLWHGLNRLACESSIMQPAKNDLVKTHLLYAVREEVEVLRDRIAELEKKLS
RLEVENKMLRETAPPDLVAQVCSGLPLTVNTTVANSTTSNANYASPSHCCSDDRCPNVDK
LNSNCSSADR
Download sequence
Identical sequences E5SJK4
EFV55030 XP_003375434.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]