SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6X537 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E6X537
Domain Number - Region: 91-112
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0235
Family Proteinase A inhibitor IA3 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6X537
Sequence length 145
Comment (tr|E6X537|E6X537_CELAD) Uncharacterized protein {ECO:0000313|EMBL:ADV48348.1} KW=Complete proteome; Reference proteome OX=688270 OS=Cellulophaga algicola (strain DSM 14237 / IC166 / ACAM 630). GN=Celal_1023 OC=Flavobacteriaceae; Cellulophaga.
Sequence
MHRLVILVALILMVSSCKEELIKPPENLITKDKMSVILYDLALVTAAKNTSVDVLKKNDI
EAMKYIYTKHGIDSLQFVESDVYYASNPEVYDEIYEGVEAKLKGDLKVVEDAKKEQRTLD
SIERIRKPKKLDSITVEKPLKPKVN
Download sequence
Identical sequences E6X537
gi|319952579|ref|YP_004163846.1| WP_013549835.1.33206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]