SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7CT36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E7CT36
Domain Number - Region: 31-74
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 0.0262
Family Clathrin heavy-chain terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7CT36
Sequence length 132
Comment (tr|E7CT36|E7CT36_9GEMI) Replication enhancer {ECO:0000256|RuleBase:RU363029} KW=Complete proteome; Reference proteome OX=932071 OS=Abutilon mosaic Bolivia virus. GN=AC3 OC=Viruses; ssDNA viruses; Geminiviridae; Begomovirus.
Sequence
MDSRTGELITAPQAENGVYIWEVDNPLYFKMYRVEDQLYTNNRVYHIQIRFNHNLRKALD
LHKCFLNFQVWTTSIQPSGTTYLSRFKSIVTMYLDELGVITINNVIRAVRYATARRYVNY
VLEDHAIKFKLY
Download sequence
Identical sequences E7CT36
YP_004207820.1.102018 gi|321961706|ref|YP_004207820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]