SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7CW81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E7CW81
Domain Number - Region: 31-70
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0196
Family N-terminal coiled coil domain from apc 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7CW81
Sequence length 74
Comment (tr|E7CW81|E7CW81_ANAPL) Eukaryotic translation elongation factor 1 delta {ECO:0000313|EMBL:ADU15765.1} OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN= OC=Anatinae; Anas.
Sequence
ILRDIARARENIQKSLAGSASTTSSGPGDQNELLSRISHLEVENQNLRSVVADLQMAIFK
LESPLNALEKSTSH
Download sequence
Identical sequences E7CW81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]