SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7DC24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7DC24
Domain Number 1 Region: 20-62
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 5.89e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7DC24
Sequence length 62
Comment (tr|E7DC24|E7DC24_9PIPI) DMRT1 {ECO:0000313|EMBL:ADT90397.1} OX=434054 OS=Xenopus cf. boumbaensis BJE-2007. GN=DMRT1 OC=Xenopus.
Sequence
PYSKTRNSGQHPSGVNTKKSPRLPKCARCRNHGYASPLKGHKRYCMWRDCQCKKCSLIAE
RQ
Download sequence
Identical sequences E7DBZ4 E7DC14 E7DC20 E7DC24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]