SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7EC45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7EC45
Domain Number 1 Region: 21-121
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 8.89e-38
Family Chemosensory protein Csp2 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7EC45
Sequence length 123
Comment (tr|E7EC45|E7EC45_ANTYA) Chemosensory protein 8 {ECO:0000313|EMBL:ADV36661.1} OX=7121 OS=Antheraea yamamai (Japanese oak silkmoth). GN= OC=Bombycoidea; Saturniidae; Saturniinae; Saturniini; Antheraea.
Sequence
MKTILALFALVAVVASTSEYYQTQYENFDANQLVENVRLLKNYIKCFLDEGPCTPEGNEF
KKAIPDALQTNCSKCSPKQRELIRIVVKGFQEKLPELWEQLSKKEDPRGEYKEAFNSFIN
STD
Download sequence
Identical sequences E7EC45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]