SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7KNV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E7KNV1
Domain Number - Region: 108-142
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0379
Family Chemosensory protein Csp2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7KNV1
Sequence length 288
Comment (tr|E7KNV1|E7KNV1_YEASL) Pex21p {ECO:0000313|EMBL:EGA82729.1} KW=Complete proteome; Reference proteome OX=764098 OS=Saccharomyces cerevisiae (strain Lalvin QA23) (Baker's yeast). GN=QA23_1975 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MPSVCHTSPIEKIIQQGHRIQNDSLIPSKRTKLAHTELTAHYATEDSHVEKHFLHNGSNF
DGIDNVRYQNQPSPLTFITPNNTVDSSDWVPQFSSMKIDDSLEFSSEYKRLYSNYESQQR
LNSSRQHLPFKNCMIRKTSCTYPPQKTLRQQRQGNRDNPTDAFQFDAEFQVLEREIQKER
YEPITRRDEKWFDQDQSELQRIATDIVKCCTPPPSSASSSSTLSSSVESKLSESKFIQLM
RNISSGDVTLKKNADGNSASELFSSNNGELVGNRHIFVKDEIHKDILD
Download sequence
Identical sequences A0A0L8VQ16 A6ZUP7 B5VJH9 C7GNJ0 C8Z9D0 E7KD30 E7KNV1 E7QFA9 H0GGX1 N1P422 P50091
YGR239C YGR239C YGR239C YGR239C YGR239C 4932.YGR239C NP_011755.3.97178 YGR239C YGR239C tr|A6ZUP7|A6ZUP7_YEAS7 YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]