SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7LWB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7LWB7
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.93e-17
Family Cold shock DNA-binding domain-like 0.0000224
Further Details:      
 
Domain Number 2 Region: 90-123
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.000000000209
Family eIF2alpha middle domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7LWB7
Sequence length 127
Comment (tr|E7LWB7|E7LWB7_YEASV) Sui2p {ECO:0000313|EMBL:EGA78181.1} KW=Complete proteome; Reference proteome OX=764099 OS=Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). GN=VIN13_2618 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSTSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQ
KLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKIP
NSFGRTI
Download sequence
Identical sequences E7LWB7 E7QGQ4
YJR007W YJR007W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]