SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7Q475 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E7Q475
Domain Number - Region: 122-165
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0366
Family Moesin tail domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7Q475
Sequence length 170
Comment (tr|E7Q475|E7Q475_YEASB) Cbp4p {ECO:0000313|EMBL:EGA58656.1} KW=Complete proteome; Reference proteome OX=764102 OS=Saccharomyces cerevisiae (strain FostersB) (Baker's yeast). GN=FOSTERSB_1897 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MQCAITPREAVIAKQRQYKHYLGMERPLWVRWLKVYAIGGAIIGSGFLLFKYTTPTDQQL
ISQLSPELRLQYEREKKLRQSEQQALMKIVKETSQSDDPIWKTGPLQSPWERNGDNVQSR
DHFAKVRAEEVQKEELARIRNELSQLRSETEEKTKEIVQDKQVKSWWRFW
Download sequence
Identical sequences E7KCP1 E7KP22 E7LUW4 E7Q475 E7QF76 N1P608
YGR174C YGR174C YGR174C SCRT_00846 4932.YGR174C YGR174C YGR174C NP_011690.3.97178 YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C YGR174C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]