SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E8KKT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E8KKT5
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Phage tail protein-like 2.43e-33
Family STM4215-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E8KKT5
Sequence length 124
Comment (tr|E8KKT5|E8KKT5_9PAST) Gp37 protein {ECO:0000313|EMBL:EFX90494.1} KW=Complete proteome; Reference proteome OX=887324 OS=Actinobacillus ureae ATCC 25976. GN=HMPREF0027_2452 OC=Pasteurellaceae; Actinobacillus.
Sequence
MQYAGSKFESLDSTDIIQQRRKVLVALTVIARSQHDDTGALEMLDQLRLAVVGFKPTNCT
PCHLISEEFAGEDNGLWQYQLIVQTETWQVEDRQAVKSAPKFAHLIKRSTTQPLDTRLKT
KQGE
Download sequence
Identical sequences E8KKT5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]