SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9CTP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9CTP2
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.83e-23
Family Ubiquitin-related 0.00037
Further Details:      
 
Domain Number 2 Region: 247-311
Classification Level Classification E-value
Superfamily XPC-binding domain 1.96e-20
Family XPC-binding domain 0.00027
Further Details:      
 
Domain Number 3 Region: 300-367
Classification Level Classification E-value
Superfamily UBA-like 8.6e-16
Family UBA domain 0.0014
Further Details:      
 
Domain Number 4 Region: 125-182
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000169
Family UBA domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9CTP2
Sequence length 371
Comment (tr|E9CTP2|E9CTP2_COCPS) UV excision repair protein {ECO:0000313|EMBL:EFW22982.1} KW=Complete proteome; Reference proteome OX=443226 OS=fungus). GN=CPSG_00881 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MKLTFRDLKQQKFTIEAEPSETIGQLKEKISQEKGWDAAQQKLIYSGKILQDVNTIESYN
IEEKGFIVCMVSKPKAQPAPSTPAGPSQTPATPAAPSSTPAAPSAPAPATNAPSAPPATP
SPATAGATFNDPSALLMGPQSETAVQQMEAMGFARDDIQRAMRAAFFNPDRAIEYLLSGI
PDHAEQEAARQQARATAPSNAAAPASTQPAANTESEEPVNLFEAAAQAAQGGGGARGTRG
GATTGEGLNNLEFLRNNPHFQQLRQLVQQQPQMLEPILQQVGAGNPQLAQLIGQNQEQFL
QLLSEDIDDDAQLPPGAHAISVTEEERDAIERLCRLGFSRDAVIQAYFACDKNEELAANF
LFEQPEDEGDN
Download sequence
Identical sequences A0A0J6I713 A0A0J6Y8D1 A0A0J8UCD2 E9CTP2 J3K7N0
CPAT_03581 CIMG_06202T0 CIRT_02994 CPSG_00881T0 CIHT_02683 XP_001242306.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]