SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GVR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GVR9
Domain Number 1 Region: 44-103
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000785
Family Tachycitin 0.046
Further Details:      
 
Domain Number 2 Region: 202-273
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000628
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 348-412
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000034
Family Tachycitin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9GVR9
Sequence length 478
Comment (tr|E9GVR9|E9GVR9_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX76479.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_322382 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAPTFLFIVLAALVHFSSAASNNFPSFRQVRRINIRKQNGRQTPAPFNCVKAGFFGDPKD
CNRFYRCVDYYGNEAQFTLFEFVCAEGTIFDESLSVCNHPHAVNPPPACLATTSLVTPTA
PTTAPTDAPTAAPTAPTVPTTEFAPDVLPVDPVTTTTAAPVPEPITAAPAPVTTTVAAPA
TTTVSSGESELTPAITPIVPPPTDAAPFMLTCNDDKFHRHPVRCDLYYKCVWTELAFSVD
LRACPPGQHYDEASGTCKSPGRTTACVFATLPPTGVVTTVPTVTTTVATEAPPAVPTTAV
ATEAPAVVPTTTVATEAPVTAAATTTALPAVETTATTAPSVPAQYTLAPGSLYDCKMPGH
YPYQLDCIRFYRCFEIEARVLKGLLYRCPIDYAYSTVTERCVRQNTLPACDRNGIRLPMD
FPVPLIPLEDTTMVLLEDFDSFFGNPNYFYIPRRKIKTNPQSSRIRNKPQPQPKNKRY
Download sequence
Identical sequences E9GVR9
jgi|Dappu1|322382|NCBI_GNO_4600138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]