SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GVS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GVS6
Domain Number 1 Region: 2-135
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.57e-39
Family FAT domain of focal adhesion kinase 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9GVS6
Sequence length 136
Comment (tr|E9GVS6|E9GVS6_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX76463.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_7154 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
KNLEPKPTARLDRTHDKVYDATKSVVRAVVLLSQGVQQAKIEKYVDLVKQVGLELRTLLT
SVDQLVPHFPPSTHREVSSFSVFFPFGDMAELVSALKLAERYSNTALDNEGMLSAAHILA
INARNLLDVVDHVRIQ
Download sequence
Identical sequences E9GVS6
jgi|Dappu1|7154|gw1.46.56.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]