SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9RJ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9RJ42
Domain Number - Region: 31-74
Classification Level Classification E-value
Superfamily MTH889-like 0.00458
Family MTH889-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9RJ42
Sequence length 81
Comment (tr|E9RJ42|E9RJ42_BACNA) Uncharacterized protein {ECO:0000313|EMBL:BAJ76957.1} OX=86029 OS=Bacillus subtilis subsp. natto. GN= OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSRELANYSSSGSVVVKRSPAVRARKVKGSAGTRARKITADGKYIPSQNLRRTISKMNSN
VRSLNDLLNKSNQIKSDQENR
Download sequence
Identical sequences E9RJ42
WP_013603240.1.33285 WP_013603240.1.42762 WP_013603240.1.47672 WP_013603240.1.51783 WP_013603240.1.55792 WP_013603240.1.84434 WP_013603240.1.88591 gi|323651117|ref|YP_004243544.1|NC_015148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]