SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0H1R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F0H1R7
Domain Number - Region: 5-59
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0942
Family Staphylocoagulase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0H1R7
Sequence length 137
Comment (tr|F0H1R7|F0H1R7_9FIRM) Putative toxin-antitoxin system, toxin component {ECO:0000313|EMBL:EGC83521.1} KW=Complete proteome OX=879306 OS=Anaerococcus hydrogenalis ACS-025-V-Sch4. GN=HMPREF9246_1271 OC=Anaerococcus.
Sequence
MNKRDIDVIVNKLIKKAGSNDLKDIISYLDIKIKKYDGKSFYLKNKNNKYIYLDINTPEE
KQDFALAHELGHSILHNSEIGQSFIYRVKSQQIENEANYFAFKILGKEIDPTYNFTINQY
ANMLNVNEEVIEYVVEG
Download sequence
Identical sequences F0H1R7
WP_004817870.1.19720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]