SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0RH41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F0RH41
Domain Number - Region: 43-101
Classification Level Classification E-value
Superfamily PMT central region-like 0.0106
Family PMT central region-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0RH41
Sequence length 110
Comment (tr|F0RH41|F0RH41_CELLC) Septum formation initiator {ECO:0000313|EMBL:ADY28079.1} KW=Complete proteome; Reference proteome OX=867900 OS=14961 / NCIMB 1423 / VKM B-1433 / Cy l20). GN=Celly_0244 OC=Flavobacteriaceae; Cellulophaga.
Sequence
MIFKKLRNKKWFGIATNMYVLVLTVFVIWMIFFDTNSLFIHNELQNQIESLEKQKEYLKD
EIARDKKIIEKLSDPKELEKFAREQYFLKKKDEEIYLIEYQDSIKTKEDE
Download sequence
Identical sequences A0A1L7E8Q7 F0RH41 W7R9B1
WP_013619827.1.31452 WP_013619827.1.36574 WP_013619827.1.53776 WP_013619827.1.62073 WP_013619827.1.93229 gi|325285160|ref|YP_004260950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]