SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0S0Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0S0Z4
Domain Number 1 Region: 48-110
Classification Level Classification E-value
Superfamily Fe-only hydrogenase smaller subunit 0.00000000000000418
Family Fe-only hydrogenase smaller subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0S0Z4
Sequence length 121
Comment (tr|F0S0Z4|F0S0Z4_DESTD) Iron hydrogenase small subunit {ECO:0000313|EMBL:ADY72798.1} KW=Complete proteome; Reference proteome OX=868864 OS=Desulfurobacterium thermolithotrophum (strain DSM 11699 / BSA). GN=Dester_0140 OC=Desulfurobacterium.
Sequence
MKEERTLPYQYEEKPASTLISRRTFLKVTGAIVSVIAISGYAITDLLKKRNKYIKMRQAG
LYKDDQRLQKKGLAASYENPVVQKFYKEFAGHPLSEVSEHLLHTKYVVRSNLKIGGGEHG
C
Download sequence
Identical sequences F0S0Z4
WP_013637758.1.33556 gi|325294343|ref|YP_004280857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]