SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0VC23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0VC23
Domain Number 1 Region: 222-354
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 9.02e-28
Family Major surface antigen p30, SAG1 0.00065
Further Details:      
 
Domain Number 2 Region: 79-217
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 6.8e-17
Family Major surface antigen p30, SAG1 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0VC23
Sequence length 385
Comment (tr|F0VC23|F0VC23_NEOCL) SRS domain-containing protein {ECO:0000313|EMBL:CBZ51157.1, ECO:0000313|EMBL:CEL68468.1} KW=Complete proteome; Reference proteome OX=572307 OS=Neospora caninum (strain Liverpool). GN=BN1204_042291 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Neospora.
Sequence
MARDWHVRCGRSQGTTTTSKMSLNYETQRKLSHNFRMGVTLLVLLASMPMHYEGPSFFSS
VRAQDETPKSKCVVDRETGTTRCTCDNTDPTPQALAATLSEDQNVLKVSCKNNELQCAPE
QLNGDKVCPQSARKLHECGSSNGSSACIPLSDILVEPGKNVTWKPDTTEASSDSATQQLT
VPPENFPYTDKKFVVGCVKKSHDDTDKCRVTVTVAARASAKKGQTVTCAYGTSSNKEPQT
ITLSPSQNAFTLVCGADGEIVPSTYQQHYCDSSENGATSDCQERDYTSILTAYQDTWWQQ
TENSSYTLQIPPTDFPEEPANIMVGCKKTKISKRGQTSETDPSTVCKVLVTIEASPNSSS
ATMSGMKAYLAVGAVAIISAFVHAM
Download sequence
Identical sequences F0VC23
XP_003881190.1.31604 psu|NCLIV_042291 psu|NCLIV_042291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]