SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0VC24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0VC24
Domain Number 1 Region: 221-353
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 8.24e-28
Family Major surface antigen p30, SAG1 0.00054
Further Details:      
 
Domain Number 2 Region: 79-216
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00000000000000103
Family Major surface antigen p30, SAG1 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0VC24
Sequence length 384
Comment (tr|F0VC24|F0VC24_NEOCL) SRS domain-containing protein {ECO:0000313|EMBL:CBZ51158.1, ECO:0000313|EMBL:CEL68469.1} KW=Complete proteome; Reference proteome OX=572307 OS=Neospora caninum (strain Liverpool). GN=BN1204_042292 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Neospora.
Sequence
MAQGWHVRCGRSQGTTTTSKMSLNYETQRKLSHNFRIGVTLLVLLASMPMHYEGPSFFSS
VRAQDETPKSKCVVDRETGTTRCTCDNTDPTPQALAATLSEDQNVLKVSCKNNELQCAPE
QLNGDKVCPQSARKLHECGSSNGSSACIPLSDILVESGESVTWSEDATETSEDCTTKQLA
VPPENFPYTDKKFLVGCIKTAGKKNQCTVTVTVAARASAKNGQTVTCAYGTSSNKEPQTI
TLSPSQNAFTLVCGTDGEIMPSTYQQQYCDSLENGTNGDCQERDYTSILTAYQDTWWQKT
ENSSYTLQIPPTDFPEEPANIMVGCKKTKISKRGQTSETDPSTVCKVLVTIEASSNSSSA
TMSGMKAYLAVGAVAIISAFVHAM
Download sequence
Identical sequences F0VC24
psu|NCLIV_042292 XP_003881191.1.31604 psu|NCLIV_042292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]