SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0VL87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0VL87
Domain Number 1 Region: 38-172
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00000000824
Family Major surface antigen p30, SAG1 0.016
Further Details:      
 
Domain Number 2 Region: 191-311
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00000068
Family Major surface antigen p30, SAG1 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0VL87
Sequence length 344
Comment (tr|F0VL87|F0VL87_NEOCL) SRS domain-containing protein {ECO:0000313|EMBL:CBZ54839.1} KW=Complete proteome; Reference proteome OX=572307 OS=Neospora caninum (strain Liverpool). GN=BN1204_052650 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Neospora.
Sequence
MRRLLYFEGVFPCCLAILVAGAFLEPISSQELGHNPSRDGQPQTCDSQERAAGSLVSSVD
LTLRPDSDSISFKCSSTLKATRTPGKEQVFAEPACSLPVTLTSLFTGATLAEDESEEGKK
TYTLTIPNDSRKATEQALYYKCTLEKELHHKNGNAVSETEGQVCKVKITVEAVNKDEPDP
EQNGEPQTSIIECSNTTSTEEASISAEAPLSFKCGTGMSLHPTNLTDVFDDQDGKCAAEV
GLQTLVDATLTKAETEATQNGQPVYQLAVKTAPSEDTALCYKCVTTSSNLETKTNSEESA
AKECLLKISVKGSASSAFSSTWGAAKTAIAFFVTVPPLLGVVDI
Download sequence
Identical sequences F0VL87
psu|NCLIV_052650 XP_003884867.1.31604 psu|NCLIV_052650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]