SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F0VL93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0VL93
Domain Number 1 Region: 191-316
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0000000549
Family Major surface antigen p30, SAG1 0.014
Further Details:      
 
Weak hits

Sequence:  F0VL93
Domain Number - Region: 43-175
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.034
Family Major surface antigen p30, SAG1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0VL93
Sequence length 348
Comment (tr|F0VL93|F0VL93_NEOCL) SRS domain-containing protein {ECO:0000313|EMBL:CBZ54845.1} KW=Complete proteome; Reference proteome OX=572307 OS=Neospora caninum (strain Liverpool). GN=BN1204_052710 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Neospora.
Sequence
MSLLRFFMSVFLIFLALSFGVLPVDRISCYYARGQDPGAAETVESCDMPGKQTTHLPLLE
LILTPNDESVSFMCSSKQDAKLTPEATKVYSDSACHDTTELSRVFAGSVLDESVVQKKKK
FTLKIPKETRKISTVLFYKCTFTGVNVGTPQRERQDAEELPAAPATECKVKITVDPLEPT
NPETEPNTEQQAGVVQCASEDGTKQATVSAESPLSFKCGAGMSLHPTNLTDVFDDQDGKC
AAEVALQTLVDATLTKAETDPPQNDQQLYQLAVTTAPSGDTALCYKCVTPSASSKAGEDL
EEGSSVKQCLLKISVKGNASSASARWGAAEGGTALLAAAQMLLGLLYV
Download sequence
Identical sequences F0VL93
XP_003884873.1.31604 psu|NCLIV_052710 psu|NCLIV_052710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]