SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MRU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MRU6
Domain Number 1 Region: 790-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000524
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MRU6
Sequence length 1406
Comment (tr|F1MRU6|F1MRU6_BOVIN) S-phase cyclin A associated protein in the ER {ECO:0000313|Ensembl:ENSBTAP00000043704} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=SCAPER OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
AKASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKSKCQTGGKSKRTIQGTH
KTSKQQNTTVDCKMTSSAAGDKHFDKSPTKTRHPRKVDLRARYWAFLFDNLRRAVDEIYV
TCESDQSVVECKEVLMMLDNYVRDFKALIDWIQLQEKLEKTDAQSRPTSLAWEVKKMSPG
RHVIPSPSTDRINVTSNARRSLNFGGSSGTVAAPRLAPTGVSWADKVKAHHTGSTASSDV
APAPSCPPVAVQKPSRRNERKDAEGWETVQRGRPVRSRSTAVMPKASLPTEALRSKDDSD
KENVHLLPDESIQKSEFVGDEPSNTIESQPKDPVHSCDHPLAERTQFTVSTLDDVKNSGS
SFLPDNSVQTSEIPAVHIDTECVSVIQQADTPSLQASEDKFSAEKARIESEMDPSDISNS
MAEVLAKKEELADRLEKANEEAIASAIAEEEQLTREIEAEENNDINLETDNDSDFSASMG
SGSVSFCGMNWNDVLADYEEIARESWRQNTSWGDIVEEEPARPPGHGIHMHEKLSSPSRK
SNRTIAESKKKHEEKQMKAQQLREKLREQKTLKLQKLLEREKEVRKWKEGLLDQRRRMME
EKLLHAEFKREVQLQAIVKKAQEEEAKVNEIAFINTLEAQNKRHDVLSKLKEYEQRLNEL
QEERQRRQEEKQARDEAVQERKRALEAERQARVEELLMKRKEQEARIEQQRQEKEKARED
AARERARDREERLAALTAAQQEAMEELQKKIQLKHDESIRRHMEQIEQRKEKAAELSSGR
HANTDYAPKLTPYERKKQCSLCNVLISSEVYLFSHIKGKKHQQAVRENSSIQGRELSDEE
VEHLSLKKYVIDIVVESTAPPEPSKDGEERQKNKKKAKKIKARMNFRAKEYESLLEAKNS
GSDSPYKAKLQRLAKDLLKQLQVQDGGSWANNKVSALDRTLGEVARILEKENVADQIAFQ
AAGGLTALEHILQVVVPVTNVNTVSRIPPKSLCNAINVYNLTCNNCSENCTDVLFSNKIT
FLMDLLIHQLTVYVPDENNAILGRNTNKQVFEGLTTGLLKVSAAVFGCLIANRPDGNSQP
TTPKISTQEMKSKPSQGDAFNSRVQDLISYVVNIGLIDKLCGCFLSVQGPVDENPKMAAF
LQHAAGLLQGMCTLCFAVTGRSYSIFDDNRQDPTGLAAALQATDLAGVLHMLYCVLFHGT
ISDPSTASPKESYAQSTVQVAIQSLRFFNSFAVLDLPAFQSIVGAEGLSLAFRHIASSLL
GHCSLVSCESLLHEVIVCVGYFTVSHPDNQVIVQSGRHPTVLQKLCQLPFQYFSDPRLIK
VLFPSLIAACYNNLQNKVILEQEMSCVLLATFIQDFAQTSGQADNQSYQPKGMSLLKLND
YLELANRFPQQAWEEARQFFFKKEKK
Download sequence
Identical sequences F1MRU6
ENSBTAP00000043704 ENSBTAP00000043704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]