SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1MSH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MSH3
Domain Number 1 Region: 323-584
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-80
Family Protein kinases, catalytic subunit 0.0000000208
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-30
Family Pleckstrin-homology domain (PH domain) 0.00017
Further Details:      
 
Domain Number 3 Region: 180-311
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-30
Family SH2 domain 0.0000254
Further Details:      
 
Domain Number 4 Region: 117-206
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-19
Family SH3-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MSH3
Sequence length 596
Comment (tr|F1MSH3|F1MSH3_BOVIN) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TEC OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LNYFDYNPHSKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSA
QSRDRWVKKLKEEIKNNNNIMIKYHPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKA
LPPTPAPEIKKRRPPPPIPPEEENGEEIVVAMYDFQATEAHDLRLERGQEYIILEKNDVH
WWKARDKYGSEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDS
SQPGMYTVSLYTKFGGEGSSGFRHYHIKETMTSPKKYYLAEKHAFGSIPEIIEYHKHNAA
GLVTRLRYPVSTKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKV
AIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLR
QRQGHFSRDMLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAGIVKVSDFGMARYVL
DDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTEGRMPFEKNTNYEVV
TMVTRGHRLHQPKLASRYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECGETFGR
Download sequence
Identical sequences F1MSH3
ENSBTAP00000043974 ENSBTAP00000043974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]