SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QET6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QET6
Domain Number 1 Region: 825-996
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0035
Further Details:      
 
Domain Number 2 Region: 971-1089
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.43e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 
Domain Number 3 Region: 189-217,293-393
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-27
Family Phosphotyrosine-binding domain (PTB) 0.0056
Further Details:      
 
Domain Number 4 Region: 10-161
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-18
Family Phosphotyrosine-binding domain (PTB) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1QET6
Sequence length 1213
Comment (tr|F1QET6|F1QET6_DANRE) TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1 {ECO:0000313|Ensembl:ENSDARP00000123160} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tbc1d1 OC=Cyprinidae; Danio.
Sequence
XQTFPGSEEKRKKEDGEEVIQYRPTLVGSLAIHPQTTMAILPWVVAEIRRPGVREKNRNL
EFNGNYSPEIRDQPVVLQISASSVCCILDTAGPGKPWNPLQHMVLFDHRPHHVTKLIHNS
QEPSYFGCLLREEKKAACYVFRCQDQLKVPEIISTLRQAGKSSARQEDTPSLPSNGQSDA
SSSTATAADAATAFAKKFEVLFCGRVVVAHKKAPPALIDECIEKFGRVSVTGSLAAGIRR
AFSLNQVVNGTNEGDGGGKRPLFFKRDQSFPFLQALDENGLSPELQRRAADGATGVQPTS
LQENRTMLFTIGRSQIFLVSPDTKKVAIEKSFREISFCSQGIRHVDHFGFICRESVECGG
CQFVCYVFQCANEALVDEIMLTLKQAFSVAALQQNSRTQSQQCDGCPLQQLHKLCDRIEG
LHPSKAKLELQKHLADLDNQEQAAVFESTMKARPKSDQEENELIFSCLRRMYEDRQKTHT
HNGQTKKDVVVNAESSVSSSRVRLEEFKSRAKRSLTESLEGIWKGGNKSKSQRENSEGES
NSSSSTTLSSTHQETSLQEPLCSLLLSSPLRSHNSTGNLKHLEGSDRGQEDPESPPQGFR
RRASTISHSPMLSSSEPSLPPLQPTAANKPKLVRHYSVSTDSPHQSNPSSSPASSSPVCQ
RPLRPRSFALDHSTRPLKRSDVAALSSPGCVIGDDSPLRNRRHSWRQQIFLRVATPQKGS
DAKESTLEVGSRMALGGGVGGGDKTLGAVPEERRKRSGAELRKLWRKAILQQILLLRMEK
ENQKLQASESDLQCKRQKLDYEEITPCLKDVTLVWERMLGTAGRAKVRFDMDEIHGAVGQ
GVPRQHRGEIWKFLSEQYLLRQEVPSAKPPNNDTPYKELLKQLTSQQHAILIDLGRTFPT
HPYFSAQLGAGQLSLYNLLKAYSLLDPEVGYCQGLSFVAGVLLLHMSEEDAFHMLKFLMY
DMGLRKQYRPDMIILQIQMYQLSRLLHDYHRELYSHLELYEIGPSLYAAPWFLTAFASHF
PLGFVARVFDMLFLQGSEVIFKVALSLLGSHKPLILQHDNLEAIVEFIKTTLPNLGLVQM
EKTINQVSEMDISKQLQAYEVEYHVLQDELLDGPSTLSHSQRAAQLEKTNGSLRQQNLDL
LEELQVAHAKIRCLETRVDGLVNREAELQSQVKTLQQEQTDLQQTVCKLRDLLSSLGISN
PCPDLQILTNNNQ
Download sequence
Identical sequences F1QET6
ENSDARP00000123160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]