SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QI81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QI81
Domain Number 1 Region: 10-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 89-133
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000379
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1QI81
Sequence length 221
Comment (tr|F1QI81|F1QI81_DANRE) Hairy-related 8a {ECO:0000313|Ensembl:ENSDARP00000111735} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=her8a OC=Cyprinidae; Danio.
Sequence
MTASNMGNGPEKNFNAKEERKLRKPLIEKKRRERINSSLEQLKGIMVDAYNLDQSKLEKA
DVLEITVQHMENLQRGHGQGGSNSPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTL
GARLLNHLLKSLPHISTEPSGTSSAGTSSPLPLSPTQSPINLPSSLQPHALLLSPSPPSS
PTHSLVRPREQSSPPSSPSPQSPASLPPFFPGVDPSMWRPW
Download sequence
Identical sequences F1QI81
NP_955918.3.45394 ENSDARP00000010206 7955.ENSDARP00000010206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]