SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F2F7N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2F7N0
Domain Number 1 Region: 7-82
Classification Level Classification E-value
Superfamily YugE-like 3.4e-26
Family YugE-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2F7N0
Sequence length 89
Comment (tr|F2F7N0|F2F7N0_SOLSS) Uncharacterized protein {ECO:0000313|EMBL:BAK15505.1} KW=Complete proteome; Reference proteome OX=1002809 OS=Solibacillus silvestris (strain StLB046) (Bacillus silvestris). GN=SSIL_1082 OC=Solibacillus.
Sequence
MNQMDNIEMNQKCVHLLEQWDPFSYGTDSYSTETADVVAALQNIDDPTTLAKVIQRVYEY
SFEQWIPFEQCVAIAYKLIAVKFEAKCII
Download sequence
Identical sequences A0A1A7LXS0 F2F7N0 K1KU35
WP_008408843.1.16583 WP_008408843.1.32796 WP_008408843.1.55795 WP_008408843.1.70781 WP_008408843.1.91521 gi|393199809|ref|YP_006461651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]